>AD-873 gnl|CDD|89570 pfam01607, CBM_14, Chitin binding Peritrophin-A do... 54 4e-009 gnl|CDD|71904 pfam08475, Baculo_VP91_N, Viral capsid protein 91 ... 33 0.012 ==> gnl|CDD|89570 pfam01607, CBM_14, Chitin binding Peritrophin-A domain. This domain is called the Peritrophin-A domain and is found in chitin binding proteins particularly peritrophic matrix proteins of insects and animal chitinases. Copies of the domain are also found in some baculoviruses. Relevant references that describe proteins with this domain include. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains.. Length = 52 Score = 54.3 bits (130), Expect = 4e-009 Identities = 21/45 (46%), Positives = 27/45 (60%) Query: 41 LFPHPTDCDKFIICSNGREVTSKCPPGLLWNDRAKRCDYPSESDC 85 L+P P DC K+ CSNG+ V CP GL+++ CDYP DC Sbjct: 8 LYPDPGDCSKYYQCSNGKAVVFTCPAGLVFDPALGICDYPDNVDC 52 Score = 45.4 bits (107), Expect = 2e-006 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 118 YIPHGTDCTKYFICDPYGVPLQQNCPPGLHWNQVVSYCDFPELAQC 163 P DC+KY+ C G + CP GL ++ + CD+P+ C Sbjct: 8 LYPDPGDCSKYYQCS-NGKAVVFTCPAGLVFDPALGICDYPDNVDC 52 ==> gnl|CDD|71904 pfam08475, Baculo_VP91_N, Viral capsid protein 91 N-terminal. This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N-terminus of the viral capsid protein 91 (VP91).. Length = 187 Score = 32.9 bits (75), Expect = 0.012 Identities = 19/58 (32%), Positives = 27/58 (46%) Query: 31 PRDDPEEPPVLFPHPTDCDKFIICSNGREVTSKCPPGLLWNDRAKRCDYPSESDCVPE 88 P +D +E P + PHPTD +KFI + V CP G ++ +C D P Sbjct: 97 PVEDNDEEPRVRPHPTDDNKFIARGDDGWVKMDCPAGERFDGNQLKCVPIPPCDGRPP 154