>AD-99 gi|6851157|gb|AAF29443.1|AF125095_1 salivary anti-thrombin pepti... 144 2e-033 gi|114864955|gb|ABI83788.1| anophelin-like funestolin [Anopheles... 69 8e-011 gi|4127344|emb|CAA76832.1| cE5 protein [Anopheles gambiae] 55 2e-006 gi|27372921|gb|AAO06834.1| salivary anti-thrombin anophelin [Ano... 51 2e-005 gi|118789501|ref|XP_317463.3| AGAP008004-PA [Anopheles gambiae s... 49 1e-004 gi|3378535|emb|CAA03874.1| F1 protein [Anopheles gambiae] 47 4e-004 gi|58263380|ref|XP_569100.1| hypothetical protein [Cryptococcus ... 38 0.22 gi|42784106|ref|NP_981353.1| leucyl aminopeptidase [Bacillus cer... 33 5.6 gi|47566957|ref|ZP_00237674.1| cytosol aminopeptidase [Bacillus ... 33 5.9 gi|168218685|emb|CAM91693.1| DNA repair and genetic recombinatio... 33 6.0 gi|166984322|ref|ZP_02255678.1| leucyl aminopeptidase [Bacillus ... 33 6.3 gi|167939467|ref|ZP_02526542.1| leucyl aminopeptidase [Bacillus ... 33 6.8 gi|30264964|ref|NP_847341.1| leucyl aminopeptidase [Bacillus ant... 33 6.9 gi|52140603|ref|YP_086226.1| leucyl aminopeptidase [Bacillus cer... 33 6.9 gi|168161669|ref|ZP_02596902.1| leucyl aminopeptidase [Bacillus ... 33 7.0 gi|118480014|ref|YP_897165.1| leucyl aminopeptidase [Bacillus th... 33 7.0 gi|49480991|ref|YP_038944.1| leucyl aminopeptidase [Bacillus thu... 33 7.1 gi|168165986|ref|ZP_02601215.1| leucyl aminopeptidase [Bacillus ... 33 7.2 gi|168156295|ref|ZP_02591528.1| leucyl aminopeptidase [Bacillus ... 33 7.3 gi|163942637|ref|YP_001647521.1| Leucyl aminopeptidase [Bacillus... 32 9.4 gi|149761976|ref|XP_001494291.1| PREDICTED: similar to zygote ar... 32 9.9 gi|148927807|ref|ZP_01811232.1| amine oxidase [candidate divisio... 32 12 gi|102140038|gb|ABF70169.1| hypothetical protein MA4_112I10.64 [... 32 15 gi|116057574|emb|CAL53777.1| unnamed protein product [Ostreococc... 31 24 gi|17975168|ref|NP_536363.1| hypothetical protein phiE125p07 [Bu... 30 45 ==> gi|6851157|gb|AAF29443.1|AF125095_1 salivary anti-thrombin peptide anophelin [Anopheles albimanus] Length = 83 Score = 144 bits (364), Expect = 2e-033, Method: Compositional matrix adjust. Identities = 72/83 (86%), Positives = 75/83 (90%), Gaps = 2/83 (2%) Query: 1 MANKLFLISLLCVVLVAKIAQAAPQYAPGEEPSYDEDTDD--KLIENDTSITDEDYAEIE 58 MANKL LISLLCVVLVAKI QAAPQYAPG+EPSYDEDTDD KL+ENDTSITDEDYA IE Sbjct: 1 MANKLVLISLLCVVLVAKITQAAPQYAPGDEPSYDEDTDDSDKLVENDTSITDEDYAAIE 60 Query: 59 ASLSQAFGTAADPGRRLGEGKKP 81 ASLS+ F TAADPGRRLGEG KP Sbjct: 61 ASLSETFNTAADPGRRLGEGSKP 83 ==> gi|114864955|gb|ABI83788.1| anophelin-like funestolin [Anopheles funestus] Length = 102 Score = 69.3 bits (168), Expect = 8e-011, Method: Compositional matrix adjust. Identities = 36/75 (48%), Positives = 50/75 (66%), Gaps = 2/75 (2%) Query: 1 MANKLFLISLLCVVLVAKIAQAAPQYAPGEEPSYDEDTDDKLIENDTSITDEDYAEIEAS 60 MA KL +I+ LC L+A + Q+APQYA GEEP+YDED D+ + + ++ D Y E + S Sbjct: 1 MATKLIVIAFLCAALIA-VVQSAPQYAQGEEPTYDEDDDEPVKPHSSADPDASYEEFDPS 59 Query: 61 -LSQAFGTAADPGRR 74 L++ TA DPGRR Sbjct: 60 QLTEYANTAQDPGRR 74 ==> gi|4127344|emb|CAA76832.1| cE5 protein [Anopheles gambiae] Length = 101 Score = 54.7 bits (130), Expect = 2e-006, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 6/78 (7%) Query: 1 MANKLFLISLLCVVLVAKIAQAAPQYAPGEEPSYDEDTDDK--LIENDTSITDEDYAEIE 58 MA+KLF+++ LC+ LV + Q+APQYA G+ P+YDE+ D+ L + +S +D+ E + Sbjct: 1 MASKLFVLAFLCLALVV-VVQSAPQYARGDVPTYDEEDFDEESLKPHSSSPSDDGEEEFD 59 Query: 59 ASLSQAFG---TAADPGR 73 SL + TA DPGR Sbjct: 60 PSLLEEHADAPTARDPGR 77 ==> gi|27372921|gb|AAO06834.1| salivary anti-thrombin anophelin [Anopheles stephensi] Length = 101 Score = 51.2 bits (121), Expect = 2e-005, Method: Compositional matrix adjust. Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 11/82 (13%) Query: 1 MANKLFLISLLCVVLVAKIAQAAPQYAPGEEPSYDEDTDDKLIENDTSITDEDYAEIE-- 58 MA+K+ +I+LLC+ L A + Q APQY GEEP YDE DD E + ++A+ E Sbjct: 1 MASKVIVIALLCIALAAFV-QGAPQYTHGEEPEYDE--DDGADEPVQPHSSSNHADTEDD 57 Query: 59 ---ASLSQAFGTA---ADPGRR 74 + L + + A ADPGRR Sbjct: 58 FDLSLLDKPYANAPENADPGRR 79 ==> gi|118789501|ref|XP_317463.3| AGAP008004-PA [Anopheles gambiae str. PEST] gambiae str. PEST] Length = 103 Score = 48.9 bits (115), Expect = 1e-004, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 6/78 (7%) Query: 1 MANKLFLISLLCVVLVAKIAQAAPQYAPGEEPSYDEDTDDK--LIENDTSITDEDYAEIE 58 MA+KLF+++ LC+ LV + Q+APQYA G+ P+YDE+ D+ L + +S +D+ E + Sbjct: 1 MASKLFVLAFLCLALVV-VVQSAPQYARGDVPTYDEEDFDEESLKPHSSSSSDDGEEEFD 59 Query: 59 ASLSQAFG---TAADPGR 73 SL + TA DPGR Sbjct: 60 PSLLEEHADAPTARDPGR 77 ==> gi|3378535|emb|CAA03874.1| F1 protein [Anopheles gambiae] Length = 73 Score = 47.0 bits (110), Expect = 4e-004, Method: Compositional matrix adjust. Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 1 MANKLFLISLLCVVLVAKIAQAAPQYAPGEEPSYDEDTDDK 41 MA+KLF+++ LC+ LV + Q+APQYA G+ P+YDE+ D+ Sbjct: 1 MASKLFVLAFLCLALVV-VVQSAPQYARGDVPTYDEEDFDE 40 ==> gi|58263380|ref|XP_569100.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] >gi|134108592|ref|XP_776949.1| hypothetical protein CNBB4770 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50259632|gb|EAL22302.1| hypothetical protein CNBB4770 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57223750|gb|AAW41793.1| conserved hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] Length = 1181 Score = 37.7 bits (86), Expect = 0.22, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 3/53 (5%) Query: 15 LVAKIAQAAPQYAPGEEPSYDEDTDDKLIENDTSITDEDYAEIEASLSQAFGT 67 +V++I + APQ+A G E + +ED D+ ENDT + D E+ A+ SQ T Sbjct: 906 IVSEILERAPQHAWGREEAVNEDQDETTGENDTKM---DEVEVPATRSQQVAT 955 ==> gi|42784106|ref|NP_981353.1| leucyl aminopeptidase [Bacillus cereus ATCC 10987] aminopeptidase (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) >gi|42740037|gb|AAS43961.1| cytosol aminopeptidase [Bacillus cereus ATCC 10987] Length = 494 Score = 33.1 bits (74), Expect = 5.6, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Query: 6 FLISLLCVVLVAKIAQAAPQYAPGEEPSYDEDTDDKL-IENDTSITDEDYAEIEASLSQA 64 F+ L + VA IA E +Y D D++ +E T+IT ED EIEA+L+ Sbjct: 111 FVTEKLDAIDVAHIAAEVQGLGTYELQTYKSDKKDRVELEKFTAITAEDTQEIEAALTVG 170 Query: 65 F--GTAADPGRRL 75 + G A + R L Sbjct: 171 YVHGRATNSARTL 183 ==> gi|47566957|ref|ZP_00237674.1| cytosol aminopeptidase [Bacillus cereus G9241] [Bacillus cereus G9241] Length = 494 Score = 33.1 bits (74), Expect = 5.9, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Query: 6 FLISLLCVVLVAKIAQAAPQYAPGEEPSYDEDTDDKL-IENDTSITDEDYAEIEASLSQA 64 F+ L + VA IA E +Y D D++ +E T+IT ED EIEA+L+ Sbjct: 111 FVTEKLDAIDVAHIAAEVQGLGTYELQTYKSDKKDRVELEKFTAITAEDTQEIEAALTVG 170 Query: 65 F--GTAADPGRRL 75 + G A + R L Sbjct: 171 YVHGRATNSARTL 183 ==> gi|168218685|emb|CAM91693.1| DNA repair and genetic recombination protein [Leuconostoc pseudoficulneum] Length = 409 Score = 33.1 bits (74), Expect = 6.0, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Query: 18 KIAQAAPQYAPGEEPSYDEDTDDKLIENDTSIT-----DEDYAEIEASLSQAFGTAADPG 72 KIA A Q P D D L ++T D+D+A +E SLS+A+ A D G Sbjct: 179 KIADALDQAQQALNPGLDGGAIDLLASAHQAMTQAASYDDDFANLEQSLSEAYYAAQDAG 238 Query: 73 RRLGE 77 R L E Sbjct: 239 RELDE 243