>anda-contig_859 gnl|CDD|86518 pfam04043, PMEI, Plant invertase/pectin methyleste... 59 1e-009 gnl|CDD|32729 COG2905, COG2905, Predicted signal-transduction pr... 37 0.003 gnl|CDD|78817 PRK12323, PRK12323, DNA polymerase III subunits ga... 37 0.004 gnl|CDD|66617 pfam02956, TT_ORF1, TT viral orf 1. TT virus (TTV)... 35 0.014 gnl|CDD|68674 pfam05109, Herpes_BLLF1, Herpes virus major outer ... 35 0.018 gnl|CDD|67608 pfam03999, MAP65_ASE1, Microtubule associated prot... 34 0.033 gnl|CDD|84650 pfam00260, Protamine_P1, Protamine P1.. 32 0.096 gnl|CDD|69476 pfam05956, APC_basic, APC basic domain. This regio... 32 0.12 gnl|CDD|86791 pfam05110, AF-4, AF-4 proto-oncoprotein. This fami... 32 0.12 gnl|CDD|66895 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd prote... 32 0.12 gnl|CDD|84229 PRK12678, PRK12678, transcription termination fact... 32 0.17 gnl|CDD|76825 PRK08853, PRK08853, DNA polymerase III subunits ga... 31 0.22 gnl|CDD|82074 PRK07003, PRK07003, DNA polymerase III subunits ga... 31 0.25 gnl|CDD|67003 pfam03363, Herpes_LP, Herpesvirus leader protein.. 31 0.30 gnl|CDD|72153 pfam08729, HPC2, Histone promoter control 2 (HPC2)... 30 0.43 gnl|CDD|33077 COG3266, DamX, Uncharacterized protein conserved i... 30 0.50 gnl|CDD|72905 cd04669, Nudix_Hydrolase_11, Members of the Nudix ... 30 0.61 gnl|CDD|82344 PRK07764, PRK07764, DNA polymerase III subunits ga... 30 0.62 gnl|CDD|64157 pfam00277, SAA, Serum amyloid A protein.. 29 0.86 gnl|CDD|82441 PRK07994, PRK07994, DNA polymerase III subunits ga... 29 0.89 gnl|CDD|82879 PRK09243, PRK09243, nicotinate phosphoribosyltrans... 29 0.94 gnl|CDD|47527 smart00197, SAA, Serum amyloid A proteins; Serum a... 29 0.95 ==> gnl|CDD|86518 pfam04043, PMEI, Plant invertase/pectin methylesterase inhibitor. This domain inhibits pectin methylesterases (PMEs) and invertases through formation of a non-covalent 1:1 complex. It has been implicated in the regulation of fruit development, carbohydrate metabolism and cell wall extension (see ). It may also be involved in inhibiting microbial pathogen PMEs. It has been observed that it is often expressed as a large inactive preprotein. It is also found at the N-termini of PMEs predicted from DNA sequences (personal obs:C Yeats), suggesting that both PMEs and their inhibitor are expressed as a single polyprotein and subsequently processed. It has two disulphide bridges and is mainly alpha-helical.. Length = 149 Score = 58.9 bits (141), Expect = 1e-009 Identities = 28/141 (19%), Positives = 51/141 (36%), Gaps = 1/141 (0%) Frame = +1 Query: 166 ACKYTSHVDRCVQSLTGKHESQGADLHGVVAMSFKVAVEVGTGVAADISKTLNTGVKDKA 345 CK T++ D CV SL+ S D + + K A+ T + ISK D Sbjct: 10 ICKSTTYPDLCVSSLSSDPRSPTTDPKDLAKAAIKAALSNATKTLSFISKLKKKA-TDPR 68 Query: 346 LWQCPSACSSGFENAIKKLDVSMAGMDRKAMADTMGWMMTVVADTEKCCGGCKHF-EGEV 522 C +++A+ +L+ ++ + D W+ + + + C G + G+ Sbjct: 69 EKAALKDCLELYDDAVDRLEKALEELKSGDYDDAQTWLSAALTNQDTCLDGFEELNTGKS 128 Query: 523 KEQLMGMMGKFGXQCSITXDL 585 + L S L Sbjct: 129 PKTLKKRNDNLKKLTSNALAL 149 ==> gnl|CDD|32729 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]. Length = 610 Score = 37.4 bits (85), Expect = 0.003 Identities = 18/65 (27%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = -1 Query: 260 MATTP--CRS-APWLSCFPVRDWTQRSTWDVYLHASGKETGQGTAGGGVWAKD*VARERQ 90 MA+ P C+S A W R W + T + LH S + AG A+D ++ Sbjct: 405 MASNPEWCKSQAEWKDTL--RRWIKEPTPEALLHLSIFFDFRPVAGDEALAEDLKQNLKR 462 Query: 89 RMRRG 75 R Sbjct: 463 RAEGN 467 ==> gnl|CDD|78817 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau. Length = 681 Score = 37.4 bits (85), Expect = 0.004 Identities = 26/118 (22%), Positives = 37/118 (31%), Gaps = 15/118 (12%) Frame = +2 Query: 104 PLNPSPTRPRRPYPVRSLCLRHANTHPTSTAASNPSRESTRARAPTCTASSPCPLR---- 271 N +P P P R A +T A+ E A A A+ P P Sbjct: 430 APNMAPAPAPAPRPEPQPARRPAAAPVAATPAAVAEPEPVAAPAAPARAAEPAPQPEVPP 489 Query: 272 WQ-----------WRSAPASPPTSQKP*TRASKTRPSGSVLVPAPVASRMLSRSSTYP 412 W+ ++S P P + RA P ++ PAP A + P Sbjct: 490 WEDLPPDLAVPGPYQSDPTRAPAAAAAPARADDDGPPATLPAPAPAAMPAPRAPTPRP 547 Score = 34.3 bits (77), Expect = 0.029 Identities = 28/121 (23%), Positives = 41/121 (33%), Gaps = 4/121 (3%) Frame = +2 Query: 92 ASP*PLNPSPT----RPRRPYPVRSLCLRHANTHPTSTAASNPSRESTRARAPTCTASSP 259 A+P P +P RP P ++ A AA + +R R A A +P Sbjct: 378 AAPAPRAAAPAAAAPAETRPEPTPAMSPARAALAAARQAARSAARGGGRMSAAPNMAPAP 437 Query: 260 CPLRWQWRSAPASPPTSQKP*TRASKTRPSGSVLVPAPVASRMLSRSSTYPWREWTGRPW 439 P AP P + A +V P PVA+ + P + PW Sbjct: 438 AP-------APRPEPQPARRPAAAPVAATPAAVAEPEPVAAPAAPARAAEPAPQPEVPPW 490 Query: 440 Q 442 + Sbjct: 491 E 491 Score = 32.3 bits (72), Expect = 0.11 Identities = 29/124 (23%), Positives = 41/124 (33%), Gaps = 4/124 (3%) Frame = +2 Query: 92 ASP*PLNPSPTRPRRPYPVRSLCLRHANTHPTSTAASNPSRES-TRARAPTCTASSP-CP 265 A P +P P A T P T A +P+R + AR +A+ Sbjct: 367 AGPATAVQAPAAAPAPRAAAPAAAAPAETRPEPTPAMSPARAALAAARQAARSAARGGGR 426 Query: 266 LRWQWRSAPASPPTSQKP*TRASKTRPSGSVLVPAPVASRMLSRSSTYPWR--EWTGRPW 439 + APA P + A + + PA VA + P R E +P Sbjct: 427 MSAAPNMAPAPAPAPRPEPQPARRPAAAPVAATPAAVAEPEPVAAPAAPARAAEPAPQPE 486 Query: 440 QTPW 451 PW Sbjct: 487 VPPW 490 ==> gnl|CDD|66617 pfam02956, TT_ORF1, TT viral orf 1. TT virus (TTV), isolated initially from a Japanese patient with hepatitis of unknown aetiology, has since been found to infect both healthy and diseased individuals and numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF1 is a large 750 residue protein.. Length = 750 Score = 35.4 bits (80), Expect = 0.014 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -2 Query: 319 RFLRCRRRRRCRPPLPP*RTWRRRRAGRRPGSRAFP*GIGRSGRRG 182 R+ R RRRRR R RRRR RR G R R RRG Sbjct: 12 RWRRWRRRRRRRRRRR-----RRRRPARRRGRRRTV----RRRRRG 48 Score = 32.0 bits (71), Expect = 0.14 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = -2 Query: 418 PPWIRRAS**HSRSHWSRH*DTARGPCL*RPCSRFLRCRRRRRCRPPLPP*RTWRRRRAG 239 W RR R W R R R R R RRR R + R R RR Sbjct: 3 YGWWRR-----RRRRWRRW---RRRRRRRRRRRRRRRPARRRGRRRTVRRRRRGRWRRRY 54 Query: 238 RR 233 RR Sbjct: 55 RR 56 Score = 31.6 bits (70), Expect = 0.16 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = +3 Query: 186 RRPLRPIPHGKAREPGRRPARRRRHVL*GGSGGRHRRRRRHLKNLEHGRQRQ 341 RR R + R P RR RRR V R R RRR+ + GR+R+ Sbjct: 18 RRRRRRRRRRRRRRPARR-RGRRRTV---RRRRRGRWRRRYRRWRRKGRRRR 65 ==> gnl|CDD|68674 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.. Length = 830 Score = 35.0 bits (79), Expect = 0.018 Identities = 25/119 (21%), Positives = 40/119 (33%), Gaps = 4/119 (3%) Frame = +2 Query: 68 IFTLSSSFASP*PLNPSPTRPRRPYPVRSLCLRHANTHPTSTAASNPSRESTRARAPTCT 247 IF + P PT P P P + + T S +PT Sbjct: 433 IFVYTLVHVEPHKTTAVPTTPSLP-PASTGPTVSTADPTSGTPTGTTSSTLPEDTSPTSR 491 Query: 248 ASSPCPLRWQWRSAPASP----PTSQKP*TRASKTRPSGSVLVPAPVASRMLSRSSTYP 412 +S P A +P PT+QK + T P+ V+ A+ + +++ P Sbjct: 492 TTSATPNATSPTPAVTTPNATSPTTQKTSDTPNATSPTPIVIGVTTTATSPPTGTTSVP 550 ==> gnl|CDD|67608 pfam03999, MAP65_ASE1, Microtubule associated protein (MAP65/ASE1 family).. Length = 619 Score = 33.9 bits (76), Expect = 0.033 Identities = 25/126 (19%), Positives = 37/126 (29%), Gaps = 5/126 (3%) Frame = +2 Query: 74 TLSSSFASP*PLNPSPTR-PRRPYPVRSLCLRHANTHPTSTAASN----PSRESTRARAP 238 S S P PS R R R N +S + S +T + Sbjct: 459 PPYGSTESSVPSTPSTRRNDRNITSNTPSLKRTPNLTKSSLSQEASLISKSTGNTHKHST 518 Query: 239 TCTASSPCPLRWQWRSAPASPPTSQKP*TRASKTRPSGSVLVPAPVASRMLSRSSTYPWR 418 ++ L RS+ + S +S GS+ +P S L R R Sbjct: 519 PRRLTTLPKLPAASRSSKGNLIRSGANGNASSDLSSPGSINSKSPEHSVPLVRVFDIHLR 578 Query: 419 EWTGRP 436 T + Sbjct: 579 ASTTKG 584 ==> gnl|CDD|84650 pfam00260, Protamine_P1, Protamine P1.. Length = 50 Score = 32.3 bits (72), Expect = 0.096 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 388 HSRSHWSRH*DTARGPCL*RPCSRFLRCRRRRRCRPPLPP*RTWRRRRAGRRPGSR 221 RS +R C R R RCRRRRR RRRR RR Sbjct: 5 CCRSR-------SRSRCRRR---RRRRCRRRRRRCGR----SRRRRRRCCRRYYRS 46 Score = 31.2 bits (69), Expect = 0.26 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +3 Query: 216 KAREPGRRPARRRRHVL*GGSGGRHRRRRRHLKNLEHGRQRQ 341 ++R RR RRR G RRRRR + R+R+ Sbjct: 9 RSRSRCRRRRRRRCRRRRRRCGRSRRRRRRCCRRYYRSRRRR 50 Score = 29.6 bits (65), Expect = 0.79 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -2 Query: 322 SRFLRCR--RRRRCRPPLPP*RTWRRRRAGRRPGSRAFP*GIGRSGRR 185 +R+ CR R RCR RRRR GR R R RR Sbjct: 1 ARYRCCRSRSRSRCRRRRRRRCRRRRRRCGRSRRRR------RRCCRR 42 ==> gnl|CDD|69476 pfam05956, APC_basic, APC basic domain. This region of the APC family of proteins is known as the basic domain. It contains a high proportion of positively charged amino acids and interacts with microtubules.. Length = 342 Score = 32.3 bits (72), Expect = 0.12 Identities = 26/111 (23%), Positives = 36/111 (32%), Gaps = 10/111 (9%) Frame = +2 Query: 80 SSSFASP*PLNPSPTRPRRPYPVRSLC------LRHANTHPTSTAASNP--SRESTRARA 235 S+ + SP R R P LC LR P + A + T+ Sbjct: 232 SAESLASSSQPASPRRGRPALPAVFLCSSRCVELRGWPRQPPNLAPQREPNAGPPTKRHD 291 Query: 236 PTCTASSPCPLRWQWRSAPASPPTSQKP*T--RASKTRPSGSVLVPAPVAS 382 T S P R R+ P T ++ + S R + S V AS Sbjct: 292 IRRT-HSESPSRLPVRAGTWRPETVKRYASLPHISVWRRTDSA-VSILSAS 340 ==> gnl|CDD|86791 pfam05110, AF-4, AF-4 proto-oncoprotein. This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X E mental retardation syndrome) nuclear proteins. These proteins have been linked to human diseases such as acute lymphoblastic leukaemia and mental retardation. The family also contains a Drosophila AF4 protein homologue Lilliputian which contains an AT-hook domain. Lilliputian represents a novel pair-rule gene that acts in cytoskeleton regulation, segmentation and morphogenesis in Drosophila.. Length = 1209 Score = 32.3 bits (72), Expect = 0.12 Identities = 16/88 (18%), Positives = 26/88 (29%), Gaps = 13/88 (14%) Frame = +2 Query: 95 SP*PLNPSPTRPRRPYPVRSLCLRHANTHPTSTAASNPSRESTRARAP------------ 238 S +PS P+R +ST +S+ S+ P Sbjct: 866 SSSSQSPSRDAPKRSRVSEDTGSSSPPKSISSTKSSSSSKPKRTEGKPKKTASSSEHAGS 925 Query: 239 -TCTASSPCPLRWQWRSAPASPPTSQKP 319 T A+ P+ P ++ KP Sbjct: 926 STDAANINSMTSPF--PVPSLPSSNAKP 951 ==> gnl|CDD|66895 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd protein. Tymoviruses are single stranded RNA viruses. This family includes a protein of unknown function that has been named based on its molecular weight. Tymoviruses such as the ononis yellow mosaic tymovirus encode only three proteins. Of these two are overlapping this protein overlaps a larger ORF that is thought to be the polymerase.. Length = 465 Score = 32.3 bits (72), Expect = 0.12 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +3 Query: 84 HPLPLPSHSILRPHAPAGRTLSGLFA*GMQIHIPRRPLRPIPHGKAREPGRR---PARRR 254 HPLP +L+ + + L + +H+ RP R RR PA RR Sbjct: 160 HPLPKTRQPVLQSRSSPRKPLHRPLSLPRSLHLH--NDRPHSPLHPRRSLRRQLQPAPRR 217 Score = 30.8 bits (68), Expect = 0.34 Identities = 26/101 (25%), Positives = 36/101 (35%) Frame = +2 Query: 98 P*PLNPSPTRPRRPYPVRSLCLRHANTHPTSTAASNPSRESTRARAPTCTASSPCPLRWQ 277 P PL+ PTRP P P R ++T P S R R + P P Sbjct: 243 PSPLHTHPTRPPLPPPYRPAK---SSTLPLSPILP-------RPRPDKRSGILPNPRLRG 292 Query: 278 WRSAPASPPTSQKP*TRASKTRPSGSVLVPAPVASRMLSRS 400 + PPTSQ P + + S + P + + R Sbjct: 293 TSTGHLPPPTSQAPPRANERLQRSLHLHSSRPNSPHLRPRR 333